SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006120 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006120
Domain Number 1 Region: 10-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-55
Family Nitrogenase iron protein-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006120   Gene: ENSGGOG00000006254   Transcript: ENSGGOT00000006284
Sequence length 271
Comment pep:novel chromosome:gorGor3.1:16:1890315:1905082:1 gene:ENSGGOG00000006254 transcript:ENSGGOT00000006284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPR
MLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSD
VAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKT
GLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALLRTLEEGH
DFIQEFPGSPAFAALTSIAQKILDATPACLP
Download sequence
Identical sequences G3QTT7
XP_004057011.1.27298 ENSGGOP00000006120 ENSGGOP00000006120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]