SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006124 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006124
Domain Number 1 Region: 53-331
Classification Level Classification E-value
Superfamily L domain-like 2.27e-55
Family Ngr ectodomain-like 0.00094
Further Details:      
 
Domain Number 2 Region: 260-565
Classification Level Classification E-value
Superfamily L domain-like 3.06e-53
Family Ngr ectodomain-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006124   Gene: ENSGGOG00000006268   Transcript: ENSGGOT00000006289
Sequence length 605
Comment pep:novel chromosome:gorGor3.1:16:1906301:1909639:-1 gene:ENSGGOG00000006268 transcript:ENSGGOT00000006289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFC
SSRNLTRLPDGIPGGTQALWLDGNNLSSISPAAFQNLSSLGFLNLQGGQLGSLEPQALLG
LENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWN
SLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQ
LPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHN
AIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLG
LTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKGN
SLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGP
LQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDC
GCPLKALRDFALQNPSAVPRFVRAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEA
HFAPC
Download sequence
Identical sequences ENSGGOP00000006124 ENSGGOP00000006124 XP_004057012.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]