SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006130 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006130
Domain Number 1 Region: 42-243
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 12-48
Classification Level Classification E-value
Superfamily PH domain-like 0.00000171
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006130
Domain Number - Region: 559-649
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000487
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006130   Gene: ENSGGOG00000006266   Transcript: ENSGGOT00000006295
Sequence length 662
Comment pep:novel chromosome:gorGor3.1:4:94835546:94914743:1 gene:ENSGGOG00000006266 transcript:ENSGGOT00000006295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKR
YGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHT
VASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKY
ICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHD
CLFPKDAELQSNPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKFESPQRSS
MNNGSPTALSGSKTNSPRNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGL
EKTQTTPNGSLQARRTSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGTPTNVRNMSWLPN
GYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPE
NSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQDDVSHPRDYESKSDHRSVGGRSSRATSS
SDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDE
LDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIW
IQ
Download sequence
Identical sequences ENSGGOP00000006130 ENSGGOP00000006130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]