SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006257 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006257
Domain Number 1 Region: 910-1101
Classification Level Classification E-value
Superfamily Bet v1-like 4.73e-61
Family STAR domain 0.00000000493
Further Details:      
 
Domain Number 2 Region: 660-824
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00068
Further Details:      
 
Domain Number 3 Region: 48-122
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.23e-33
Family Variant SAM domain 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006257   Gene: ENSGGOG00000006398   Transcript: ENSGGOT00000006426
Sequence length 1113
Comment pep:novel chromosome:gorGor3.1:13:14964617:15149442:-1 gene:ENSGGOG00000006398 transcript:ENSGGOT00000006426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMK
LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNT
TSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCCTDNPVMLDAPVVSSSLSQPPRDVL
NHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLRQEPESFKA
MQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKERKCHEANKRG
GMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDS
SNGVNWRTGSISLGREQVPGAREPRLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKD
DLFPHLDDILQHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLSPFPSPNQITLDFEGNS
VSEGRTTPSDVERDVTSLNESELPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAP
ASPHISSQTASQLSLLQRFSLLRLTAIMEKHSMSNKHGWTWSVPKFMKRMKVPDYKDKAV
FGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHALRQMNENFPEN
VNYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVSKEQRLQAVQAAILLLAD
ENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG
KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLE
ESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVE
APPSVVLNRVLRERHLWDEDFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKT
DLPKGMCTLVSLSVEHEEAQLLGGVRAVVMDSQYLIEPCGSGKSRLTHICRIDLKGHSPE
WYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI
Download sequence
Identical sequences ENSGGOP00000006257 ENSGGOP00000006257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]