SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006301 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006301
Domain Number 1 Region: 2290-2362
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 906-975
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.32e-19
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 3 Region: 1641-1712
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.24e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2005-2076
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.31e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 355-421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-18
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 6 Region: 2083-2217
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 714-854
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 1802-1928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 2405-2533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 491-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 11 Region: 655-728
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.16e-16
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 12 Region: 209-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.9e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 13 Region: 982-1112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 14 Region: 1272-1407
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000118
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 15 Region: 1481-1554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 16 Region: 1150-1290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000127
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 17 Region: 2175-2292
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 18 Region: 2530-2646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 1560-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 20 Region: 2365-2410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000437
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 21 Region: 1110-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000527
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 22 Region: 1966-2019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 23 Region: 608-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000015
Family EGF-type module 0.004
Further Details:      
 
Domain Number 24 Region: 250-367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 25 Region: 860-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 26 Region: 1438-1485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000135
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 27 Region: 1719-1773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 28 Region: 1397-1445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000691
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 29 Region: 1921-1963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 30 Region: 1762-1800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000694
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006301
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2739-2785
Classification Level Classification E-value
Superfamily Cadherin-like 0.00576
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006301   Gene: ENSGGOG00000006425   Transcript: ENSGGOT00000006470
Sequence length 2824
Comment pep:novel chromosome:gorGor3.1:5:111553138:111836430:-1 gene:ENSGGOG00000006425 transcript:ENSGGOT00000006470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRRLCLQLYFLWLGCVVLWAQGTAGQPQPPPPKPPRPQPPPQQVRSATAGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISPTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDHDECTTTNMCLNGMCINEDGSFKCI
CKPGFVLAPNGRYCTDVDECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHM
RSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGI
TVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCD
NGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSK
LSSTGLICIDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNGKGSFHCECPEGLTL
DGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEY
ETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFALDM
EERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLL
CRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCN
PGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECE
NNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKGSF
ICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCID
LDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNV
PGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGG
NCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGD
GSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIIL
EDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTC
YNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNV
GKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQI
GSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNG
ACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTC
KNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELT
PDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICL
FGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCC
SKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCI
NTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPM
MNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESR
GMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCECNEG
FQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELCPLP
GTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTS
CIDLDECSQSPKPCNFICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFLCV
NTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDAT
GLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSAS
CYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRV
GQGHCVSGMGFNKGQYLSLDTEVDEENALSPEACYECKINGYSKKDSRQKRSIHEPDSTA
VEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIH
QRNGLSYLHTAKKKLMPGTYTLEITSIPLYKKKELKKLEESNEDDYLLGELGEALRMRLQ
IQLY
Download sequence
Identical sequences ENSGGOP00000006301 ENSGGOP00000006301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]