SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006372 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006372
Domain Number 1 Region: 331-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.93e-21
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 2 Region: 87-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000204
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006372   Gene: ENSGGOG00000006511   Transcript: ENSGGOT00000006542
Sequence length 434
Comment pep:novel chromosome:gorGor3.1:5:43142106:43148504:1 gene:ENSGGOG00000006511 transcript:ENSGGOT00000006542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGACATSRCQTPSFLSRSRGLTGCLL
PCYFTGSRNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLANYLEKVRSLEETNAELESR
IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDEFKSKYER
YESELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLRGQ
LGDRLSVELDTAPTLDLNRVLDEMRCQYETVLANNRREAEEWLAVQTEELNQQQLSSAEQ
LQGCQTEILELKRTASALEIELQAQQSLTEYLECTVAETEAQYSSQLAQIQCLIDNVENQ
LAEIRYDLERQNQEYQVLLDVKARLEGEINTYQGLLDSEDSRLSCSPCSTTCTSSNTCEP
CSAYVICTVENCCL
Download sequence
Identical sequences ENSGGOP00000006372 ENSGGOP00000006372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]