SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006440 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006440
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Prefoldin 7.72e-27
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006440   Gene: ENSGGOG00000006583   Transcript: ENSGGOT00000006610
Sequence length 129
Comment pep:novel chromosome:gorGor3.1:6:34255629:34256780:1 gene:ENSGGOG00000006583 transcript:ENSGGOT00000006610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQA
AKAGAPGKA
Download sequence
Identical sequences A0A096NHH3 A0A0D9RB28 A0A1S3A0M3 A0A1S3GQ86 A0A1U7TBI2 A0A250Y9N9 A0A2I2YD85 A0A2I3HQ15 A0A2K5CV76 A0A2K5J6H1 A0A2K5LXQ1 A0A2K5QRK7 A0A2K5YRE7 A0A2K6BKJ2 A0A2K6JU74 A0A2K6RH00 A0A2K6UZT1 F6SFR8 F7HXU8 G1SZJ5 G7P2S7 H2QST1 I0FNG3 I3NCR1 O15212 Q5STK2 S9X7T2
ENSOPRP00000000807 ENSOPRP00000000900 ENSECAP00000022753 ENSSTOP00000022158 ENSOCUP00000009098 ENSP00000363734 ENSP00000363735 ENSP00000363738 ENSP00000372694 ENSP00000378563 ENSP00000382314 ENSP00000382316 ENSP00000395462 ENSP00000398171 ENSP00000400152 ENSP00000402212 ENSP00000402553 ENSP00000403771 ENSP00000404773 ENSP00000412319 ENSP00000415678 ENSP00000447540 ENSP00000448607 ENSP00000448784 ENSP00000449925 ENSDORP00000013000 ENSOCUP00000009098 ENSSTOP00000022158 ENSNLEP00000008329 ENSGGOP00000006440 ENSP00000363734 ENSP00000363735 ENSP00000363738 ENSP00000372694 ENSP00000378563 ENSP00000382314 ENSP00000382316 ENSP00000395462 ENSP00000398171 ENSP00000400152 ENSP00000402212 ENSP00000402553 ENSP00000403771 ENSP00000404773 ENSP00000412319 ENSP00000415678 ENSP00000447540 ENSP00000448607 ENSP00000448784 ENSP00000449925 gi|297747286|ref|NP_001172110.1| gi|7657162|ref|NP_055075.1| ENSMMUP00000005164 ENSPANP00000012421 ENSP00000363734 ENSP00000372694 ENSP00000395462 ENSP00000398171 ENSP00000400152 ENSNLEP00000008329 ENSDORP00000013000 ENSGGOP00000006440 ENSMMUP00000005164 9544.ENSMMUP00000005164 9598.ENSPTRP00000030812 9606.ENSP00000363734 9606.ENSP00000372694 9606.ENSP00000407488 9606.ENSP00000412319 9606.ENSP00000415678 9796.ENSECAP00000022753 9986.ENSOCUP00000009098 NP_001172110.1.87134 NP_001172110.1.92137 NP_001181794.1.72884 NP_001252524.1.87134 NP_001252524.1.92137 NP_001252525.1.87134 NP_001252525.1.92137 NP_055075.1.87134 NP_055075.1.92137 XP_002714586.1.1745 XP_002746442.1.60252 XP_003923193.1.74449 XP_004043860.1.27298 XP_004424332.1.5094 XP_005318876.1.77405 XP_005553381.1.63531 XP_005553382.1.63531 XP_005603862.1.31192 XP_005603863.1.31192 XP_006180569.1.101512 XP_006202188.1.17985 XP_007527493.1.11023 XP_007971144.1.81039 XP_007971145.1.81039 XP_007971146.1.81039 XP_008053743.1.4292 XP_008058397.1.4292 XP_008058406.1.4292 XP_008541944.1.77740 XP_008541945.1.77740 XP_009449284.1.37143 XP_009449285.1.37143 XP_010332317.1.74449 XP_010332318.1.74449 XP_010356154.1.97406 XP_010356155.1.97406 XP_010947392.1.22495 XP_010947393.1.22495 XP_010992857.1.51371 XP_010992859.1.51371 XP_011727389.1.29376 XP_011727390.1.29376 XP_011727391.1.29376 XP_011800870.1.43180 XP_011800871.1.43180 XP_011800872.1.43180 XP_011841841.1.47321 XP_011841842.1.47321 XP_011841843.1.47321 XP_011841844.1.47321 XP_011932117.1.92194 XP_011932129.1.92194 XP_011932139.1.92194 XP_011932148.1.92194 XP_012317130.1.9421 XP_012317131.1.9421 XP_012358572.1.23891 XP_012358573.1.23891 XP_012358574.1.23891 XP_012890429.1.60039 XP_014411197.1.101512 XP_014638319.1.5094 XP_014701812.1.49734 XP_014701813.1.49734 XP_014991557.1.72884 XP_015093034.1.17985 XP_015343046.1.40921 XP_016074203.1.3490 XP_016074204.1.3490 XP_016074205.1.3490 XP_017378182.1.71028 XP_017378183.1.71028 XP_017378184.1.71028 XP_017514451.1.32401 XP_017744749.1.44346 XP_017744750.1.44346 XP_018884680.1.27298 XP_018884682.1.27298 XP_018884683.1.27298 XP_020019751.1.5219 XP_020737564.1.74333 XP_020737565.1.74333 ENSPTRP00000030812 ENSOPRP00000000807 ENSOPRP00000000900 ENSCJAP00000040327 ENSPTRP00000030812 ENSCJAP00000040327 ENSECAP00000022753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]