SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006462 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006462
Domain Number 1 Region: 446-751
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-70
Family Protein kinases, catalytic subunit 0.0000012
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-32
Family cAMP-binding domain 0.00094
Further Details:      
 
Domain Number 3 Region: 151-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.82e-28
Family cAMP-binding domain 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006462
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006462   Gene: ENSGGOG00000006600   Transcript: ENSGGOT00000006633
Sequence length 765
Comment pep:novel chromosome:gorGor3.1:4:89851290:89968367:-1 gene:ENSGGOG00000006600 transcript:ENSGGOT00000006633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNMIPFSHDIVSHTV
NLLVITIQEDVSPKSTVKKYSITIDNLHKNLFTEEIGAHQHGMKIKKTHFLRWLNGFNWE
GLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Download sequence
Identical sequences ENSGGOP00000006462 ENSGGOP00000007258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]