SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006473 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006473
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 4.55e-75
Family Arrestin/Vps26-like 0.000000431
Further Details:      
 
Domain Number 2 Region: 179-367
Classification Level Classification E-value
Superfamily E set domains 1.4e-55
Family Arrestin/Vps26-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006473   Gene: ENSGGOG00000006608   Transcript: ENSGGOT00000006644
Sequence length 391
Comment pep:novel chromosome:gorGor3.1:X:67502307:67514657:1 gene:ENSGGOG00000006608 transcript:ENSGGOT00000006644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IANMSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKGRKLFVMLTCAF
RYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMV
TNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEEIVSKRDYVRLVVRKVQFAPPEAGP
GPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITD
VVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNL
ASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHAS
ASSEDIVIEEFTRKGEEESQKAVEAEGDEGS
Download sequence
Identical sequences ENSGGOP00000006473 ENSGGOP00000018259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]