SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006493 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006493
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Sema domain 3.79e-118
Family Sema domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1314-1443,1620-1806
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-49
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 893-982
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000171
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 4 Region: 801-895
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000024
Family Other IPT/TIG domains 0.0077
Further Details:      
 
Domain Number 5 Region: 469-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000436
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 981-1095
Classification Level Classification E-value
Superfamily E set domains 0.0000045
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006493
Domain Number - Region: 765-798
Classification Level Classification E-value
Superfamily Plexin repeat 0.0314
Family Plexin repeat 0.0041
Further Details:      
 
Domain Number - Region: 1467-1559
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0653
Family Ubiquitin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006493   Gene: ENSGGOG00000006625   Transcript: ENSGGOT00000006664
Sequence length 1839
Comment pep:novel chromosome:gorGor3.1:22:35140557:35165608:-1 gene:ENSGGOG00000006625 transcript:ENSGGOT00000006664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAK
LQLEQQVATGPALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGIC
ALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCLAASVAAPGSGRVLYAVFSRD
SRSSGGPGAGLCLFPLDEVHAKMEANRNACYTGTLEARDIFYKPFHGDIQCGGHALGSSK
SFPCGSEHLPYPLGSRDGLKGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL
TPDGTSSEYDSILVEINKRVKRDLVLSGDLASLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAITSARPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRR
GNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNPEDGIVRA
HMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGGCPRDPHPAPLCGGRKC
SVPLRVPQLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRC
AWCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRIS
VAGRNCSFQPERYSVSTRIVCVIEAAEAPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLS
VEPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQM
LLEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVI
AEPLQSWQPPREAESLQPMTVVGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHR
ALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTM
KTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLS
LILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIE
MEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQF
SNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELLEQ
YVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDA
VQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVY
RGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILS
KVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITE
IYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIW
KTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKL
LYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQ
KYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences ENSGGOP00000006493 ENSGGOP00000006493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]