SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006607 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006607
Domain Number 1 Region: 3004-3179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.83e-32
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2834-2997
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.82e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2436-2607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 2606-2775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.3e-19
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 5 Region: 2236-2432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000475
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 1257-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1588-1637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 8 Region: 1640-1690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 9 Region: 437-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 10 Region: 1167-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 392-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 257-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 13 Region: 532-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 1306-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 327-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 16 Region: 585-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006607
Domain Number - Region: 487-529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 1219-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Laminin-type module 0.049
Further Details:      
 
Domain Number - Region: 1553-1590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.051
Further Details:      
 
Domain Number - Region: 1761-2004
Classification Level Classification E-value
Superfamily Tropomyosin 0.00386
Family Tropomyosin 0.008
Further Details:      
 
Domain Number - Region: 1945-2164
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006607   Gene: ENSGGOG00000006722   Transcript: ENSGGOT00000006780
Sequence length 3180
Comment pep:novel chromosome:gorGor3.1:18:20721054:20964097:1 gene:ENSGGOG00000006722 transcript:ENSGGOT00000006780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQGQFCDYCNSEDPRKAHPVTNAIDGSERWWQSPPLSSGTQYNRVNLTLDLGQLIIVKPV
TLIFASLKPRKDSWEQLSIEYSSYKKYYLKERKRLLTNMSHGMHIHKACVHPPALLCEAK
YSNMTCFNKHVVSCKIPIFRPIGKICVFFLLLELTMRMSLRESKLQSSTLWAPYVRPPAP
SPGEQQQNYLKNFEACMQCVMFPRVLFCYLNLIPEELYMMFCNNFAINKWCNKCVINEHH
HEAQPLKYNEYIVCLTCNCHGHASDCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAG
VNCEQCAKGYYRPYGVPVDAPDGCIPCSCDPEHADGCEQGSGRCHCKSNFHGDNCEKCAI
GYYNFPFCLRIPIFPVSTPSSEDPVAGDIKGCDCNLEGVLPEICDAHGRCLCRPGVEGPR
CDTCRSGFYSFPICQACWCSALGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHC
QGSSSACDPAGTINSNLGYCQCKLHVEGPTCSSCKLLYWNLDKENPSGCSECQCHKAGTV
SGTGECRQGDGDCQCKSHVGGDSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSVCSGP
SGVCQCREHVVGKVCQRPENNYYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWR
GYAQMTSVQNDVRITLNVGKSSGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIF
LPSKEPAFVTVPGNGFADPFSITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTE
PCAYAGPPQEKSLLYQHLPVTRFPCTLACEARHFLLDGEPRSVAVRQPTPAHPVMVDLSG
REVELHLRLRVPQVGHYVVVVEYSTEAAQLFVVDVNVKSPGSVLAGQVNIYSCNYSVLCR
SAVIDHMSRIAMYELLADADIQLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGR
FVNQSATCVSLAHETPPTALILDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRG
RVPHLGRYVFVIHFYQAAHPTFPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIE
FDISEPEVAATVKIPEGKSLVLVRVLAVPAENYDYQILHKKSMDKSLEFITNCGKNSFYL
DPQTASRFCKNSARSLVAFYHKGALPCECHPTGATGPHCSPEGGQCPCRPNIIGRQCTRC
ATGHYGFPRCKPCSCGRRLCEEMTGQCHCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCS
RRGTIEAAMPECDRDSGQCRCKPRITGRRCDRCASGFYRFPECVPCNCNRDGTEPGVCDP
GTGACLCKENVEGTECNVCREGSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDML
GWHLETADRVDIPVSFNPGSNSMVADLQELPATVHSASWVAPTSYLGDKVSSYGGYLTYQ
AKSFGLPGDMVLLEKKPDVQLTGQHMSIIYEETNTPRPDRLHHGRVQVVEGNFRHASSRA
PVSREELMTVLSRLADVRIQGLYFTETQRLTLSEVGLEEASDTGSGRIALAVEICTCPPA
YAGDSCQGCSPGYYRDHKGLYTGQCVPCNCNGHSNRCQDGSGICVNCQHNTEGEHCERCQ
EGYYGNAVHGSCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQK
FGGSCQPCSCNSNGQLGSCHPLTGDCMNQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQ
LRLVKSQLQGLSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLN
QEFETLQEKAQVNSRKAQTLYNNVNQATQSAKELDVKIKNVIRNVHVLNRIRTWQKTHQG
ENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINS
LQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGK
TSLVEEAEKHAQSLQELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANR
AASASESALQTVIKEDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIV
TVQKEVIDTNLTTLRDGLRGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVER
IKDTYGRTQNEDFKKALTDADNSATVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRI
RELIQQARDAASKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTEN
MFVMYLGNKDASRDYIGMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQ
RIYQFARLNYTKGATSSKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRL
SFPPYKGCIELDDLNENVLSLYNFKNTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPT
QPHAPIPTFGQTIQTTVDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSEPPKERGVGDA
INNGRDHSIQIKIGKLQKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPA
FRGCMKNLKKTSGVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQA
SFGFQTFQPSGILLDHQTWTRNLQVTLEDGYIELSTSDSSGPIFKSPQTYMDGLLHYVSV
ISDNSGLRLLIDDQPLRNNKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDL
TSNSLKRDVSLGGCSLNKPPFLMLLKGSTRFNKTKTFRINQLLQDTPMASPRSMKVWQDA
CSPLPKTQANHGALQFGDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNS
FMALYLSKGRLVFALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGS
LPGNSTISIRAPVYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGG
PLEKGVYFSEEGGHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAG
KVTASMDSGAGGTSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPA
STQEPLHLGGAPANLTTLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDH
Download sequence
Identical sequences ENSGGOP00000006607 ENSGGOP00000025956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]