SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006652 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006652
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 2.61e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 379-481
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000017
Family Integrin beta tail domain 0.0089
Further Details:      
 
Domain Number 4 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000199
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 601-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family Integrin beta EGF-like domains 0.0053
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006652
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006652   Gene: ENSGGOG00000006795   Transcript: ENSGGOT00000006825
Sequence length 798
Comment pep:novel chromosome:gorGor3.1:12:51212063:51227709:-1 gene:ENSGGOG00000006795 transcript:ENSGGOT00000006825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALPMVLILLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCAPREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DTDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Download sequence
Identical sequences ENSGGOP00000006652 ENSGGOP00000006652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]