SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006687 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006687
Domain Number 1 Region: 94-204
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.23e-41
Family FAD-dependent thiol oxidase 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006687   Gene: ENSGGOG00000006835   Transcript: ENSGGOT00000006860
Sequence length 205
Comment pep:novel chromosome:gorGor3.1:16:2102765:2106362:1 gene:ENSGGOG00000006835 transcript:ENSGGOT00000006860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQALTSDSP
VTEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL
PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNQPDTRTRACFTQWLCHLHNEVNRK
LGKPDFDCSKVDERWRDGWKDGSCD
Download sequence
Identical sequences G3QVC3
XP_004057029.1.27298 ENSGGOP00000006687 ENSGGOP00000006687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]