SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006813 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006813
Domain Number 1 Region: 692-889
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-69
Family Sec7 domain 0.00000944
Further Details:      
 
Domain Number 2 Region: 60-96,126-194,395-575,1000-1027,1083-1153
Classification Level Classification E-value
Superfamily ARM repeat 0.000000115
Family Armadillo repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006813   Gene: ENSGGOG00000006948   Transcript: ENSGGOT00000006992
Sequence length 1754
Comment pep:novel chromosome:gorGor3.1:10:115818160:116096471:1 gene:ENSGGOG00000006948 transcript:ENSGGOT00000006992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIGADPTHEGTAEGMENMADAVTH
ARFVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLR
KSAEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMRAGGMSDSSKWKKQKRSPRPPR
HMTKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSS
QTTSKEDLTDLEQPGSPGYSTATEPGSSELGVPKQPDLQEGTHAEKSQSASVESIPEVLE
ECTSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPH
DRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLR
VCFLLFESMREHLKFQMEMYIRKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTEL
YINYDCDYYCSNLFEDLTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLN
SLTQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGK
PGCSDLEEAVDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGI
QFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRL
DEALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQH
NHNVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENY
VWNVLLHRGATPEGIFLRVPAASYDLDLFTMTWGPTIVIQKAISGFRKCAMISAHYGLSD
VFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIME
AMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSS
VRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALVSVTPDEETYDEED
AAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAVRLLR
REEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLEC
IGSGVKPPAALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKI
HRSATDADVVNSGWLVVGKDDIDNSKPGPSRPGPSPLINQYSLTVGLDLGPHDTKSLLKC
VESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGSRFKKK
SKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASI
YSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRAL
LVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRASTLLSKVFLQHLS
PLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDTAEIFHSADARGG
GPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAHLTSAAGDTRTPG
HPPPPEIPSELGAC
Download sequence
Identical sequences ENSGGOP00000006813 ENSGGOP00000006813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]