SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006821 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006821
Domain Number 1 Region: 7-242
Classification Level Classification E-value
Superfamily HAD-like 6e-37
Family HAD-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006821   Gene: ENSGGOG00000006974   Transcript: ENSGGOT00000007000
Sequence length 251
Comment pep:novel chromosome:gorGor3.1:9:95906927:95910420:-1 gene:ENSGGOG00000006974 transcript:ENSGGOT00000007000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRLQIRLLTWDVKDTLLRLRHPLGEEYATKARAHGLEVEPSALEQGFRQAYRAQSHSF
PNYGLSHGLTSHQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDT
LRECRTRGLRLGVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLA
HMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPA
LDCLEGSTPGL
Download sequence
Identical sequences G3QVP3
ENSGGOP00000006821 ENSGGOP00000006821 XP_004048519.1.27298 XP_004048520.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]