SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006825 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006825
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 227-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000575
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000732
Family Fibronectin type I module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006825   Gene: ENSGGOG00000006978   Transcript: ENSGGOT00000007004
Sequence length 381
Comment pep:novel chromosome:gorGor3.1:1:87881421:87884538:1 gene:ENSGGOG00000006978 transcript:ENSGGOT00000007004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWICDEDSIKDPMEDQDGLLG
KELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCS
KTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVRFTY
AGCLSVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNCP
HANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences G3QVP6
ENSGGOP00000006825 XP_004026115.1.27298 ENSGGOP00000006825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]