SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006834 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006834
Domain Number 1 Region: 542-712
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-55
Family Sec7 domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 750-871
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-27
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006834   Gene: ENSGGOG00000006985   Transcript: ENSGGOT00000007013
Sequence length 1024
Comment pep:novel chromosome:gorGor3.1:10:115977991:115995305:-1 gene:ENSGGOG00000006985 transcript:ENSGGOT00000007013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGLPAP
PQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQVDTWSSPREVSSHAQRIARAKW
EFFYGSLDPPSSGAKPPEQAPPSPPGVSSRQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPCPGPHPSLGSGNEDEDDDEAGGE
EDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQ
RGEEEEAEARAKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLA
LGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLL
NTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRS
LSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGK
RGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLR
VKLKAGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSG
RRKP
Download sequence
Identical sequences G3QVQ5
ENSGGOP00000006834 ENSGGOP00000006834 XP_018890191.1.27298 XP_018890192.1.27298 XP_018890193.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]