SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006930 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006930
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 6.29e-46
Family Nucleoside diphosphate kinase, NDK 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006930
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006930   Gene: ENSGGOG00000007089   Transcript: ENSGGOT00000007115
Sequence length 222
Comment pep:novel chromosome:gorGor3.1:5:121636999:121661362:-1 gene:ENSGGOG00000007089 transcript:ENSGGOT00000007115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLHLSPEQCSNFYVE
QYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNSSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPVGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPYLKKNPQKNKS
Download sequence
Identical sequences G3QVZ0
XP_004042625.1.27298 XP_018882877.1.27298 XP_018882878.1.27298 ENSGGOP00000006930 ENSGGOP00000006930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]