SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006950 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006950
Domain Number 1 Region: 321-355
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000824
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006950   Gene: ENSGGOG00000007105   Transcript: ENSGGOT00000007135
Sequence length 389
Comment pep:novel chromosome:gorGor3.1:2b:107283265:107295157:1 gene:ENSGGOG00000007105 transcript:ENSGGOT00000007135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKVYSTGSRAKDHQPSGAECLPLPEANAEAIDFLISLHEEELQMLFFSETLAMVSDTG
EPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHS
QDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVL
LRVMAWRRMVPSNARFLTLDTEGKLCHLTYRSNPSAQKYSHNHYSGEKFLSTSVSHYNNG
LGRFSLSHVVLHSRHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDME
LYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWR
PSSPALGSSHRPNPFRSLEPQGDARSGAA
Download sequence
Identical sequences ENSGGOP00000027735 ENSGGOP00000006950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]