SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006971 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006971
Domain Number 1 Region: 959-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000785
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 919-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006971
Domain Number - Region: 1084-1170
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00062
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006971   Gene: ENSGGOG00000007120   Transcript: ENSGGOT00000007157
Sequence length 1285
Comment pep:novel chromosome:gorGor3.1:3:124664317:124748996:-1 gene:ENSGGOG00000007120 transcript:ENSGGOT00000007157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRASRWPPPLLLLLLPLLLLPPAAPGTRDPPPSPARRALSLAPLAGAGLELQLERRP
EREPPPTPPRERRGPATPGPSYRAPEPGAATQRGPSGRAPRGGSADAAWKHWPESNTEAH
VENITFYQNQEDFSTVSSKEGVMVQTSGKSHAASDAPENLTLLAETADARGRSGSSSRTN
FTILPVGYSLGIATALTSQSGNLASESLHLPSSSSEFDERIAAFQTKSGTASEMGTERAM
GLSEEGTVHSQEATTSAWSPSFLPALEMGELTTPSRKRNSSGPDLSWLHFYRTAASSPLL
DLSTSSESTEKLNNSTGLQSSSVSQTKTMHVATVFTDGGPRTLRSLTVSLGPVSKTESFP
KDSRIATTSASVLLSPSAVESRRNSRVTGNPGDEEFIEPSTENEFGLTSLHWQNDSPTFG
EHQLASSSEVQNGSPMSQTETVSRSVAPMRGGEITAHWLLTNSTTGISYGQVRGTAIEQR
TSSDHTDHTYLSSTFTKGERALLSITDNSSSSDIVESSTSYIKISNSSHSEYSSFFHAQT
ERSNISSYDGEYAQPSTESPVLHTSNLPSYTATINMPNTSVVLDTDAEFVSDSSSSSSSS
SSSSSSGPPLPLPSVSQSHHLFSSILPSTRASVHLLKSTSDASTPWSSSPSPLPVSLTTS
TSAPLSVSQTTLPQSSSTPVLPRARETPVTSVQTSTMTSFMTMLHSSQTADLKNQSTPHQ
EKVITESKSPSLVSLPTESTKAVTTNSPLPPSLTESSTEQTLPATSTNLAQMSPTFTTTI
LKTSQPLMTTPGTLSSTASLVTGPIAVQTTAGKQLSLTHPEILVPQISTEGGISTQRNQV
IVDATTGLIPLTSVPTSAKEMTTKLGVTAEYSPASRSLGTSPSPQTTVVSTAEDLAPKSA
TFAVQSSTQSPTTLSSSASVNSCAVNPCLHDGECIADNTSRGYHCRCPPSWQGDDCSVDV
NECLSNPCPSMATCNNTQGSFICKCPVGYQLEKGICNLVRTFVTEFKLKRTFLNTTVEKH
SDLQEVENEITKTLNMCFSALPSYIRSTVHASRESNAVVISLQTTFSLASNVTLFDLADR
MQKCVNSCKSSAEVCQLLGSQRRIFRAGSLCKRKSPECDKDTSICTDLDGVALCQCKSGY
FQFNKMDHSCRACEDGYRLENETCMSCPFGLGGLNCGNKNKNDISKLIFKSGDFQMSPYA
EYPKNPRSQEWGREAIEMHENGSTKNLLQMTDVYYSPTSVRNPELERNGLYPAYTGLPGS
RHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences ENSGGOP00000006971 ENSGGOP00000006971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]