SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006973 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006973
Domain Number 1 Region: 493-694
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-45
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 7.06e-35
Family Bcr-Abl oncoprotein oligomerization domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 708-777,835-870
Classification Level Classification E-value
Superfamily PH domain-like 7.55e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 1171-1220
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000608
Family BCR-homology GTPase activation domain (BH-domain) 0.0018
Further Details:      
 
Domain Number 5 Region: 911-1014
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000039
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006973   Gene: ENSGGOG00000007144   Transcript: ENSGGOT00000007159
Sequence length 1275
Comment pep:novel chromosome:gorGor3.1:22:6990555:7124334:1 gene:ENSGGOG00000007144 transcript:ENSGGOT00000007159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGACSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPHLEYHPYQSIYVGGMMEGEGKGPLMRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADTDGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALV
SGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVL
TSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNY
GVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLH
DLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVEL
VEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPL
VPDEELDALKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHS
RNGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLT
INKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNW
NEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLGPQFLPGLRRTQR
QNTGSNPLVVKYQVPKLIRELSGSEPPGAPYTSRSGLKAKRLLKHTSISVSYLIHCLMDL
ARRLRSNSFIYKRLVGIREEKQGVKSGMDLRRADCGHRLQQEACDLSPGEHRGWFTHSPL
PAPAEGLLPYPAQGDRSSDLVHPPETTAFTWLVSLPAVNLLTFLFLLDHLKRVAEKEAVN
KMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIP
APDSKRQSILFSTEV
Download sequence
Identical sequences ENSGGOP00000006973 ENSGGOP00000006973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]