SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006992 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006992
Domain Number 1 Region: 41-507
Classification Level Classification E-value
Superfamily Sema domain 5.49e-131
Family Sema domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 1352-1479,1675-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 952-1039
Classification Level Classification E-value
Superfamily E set domains 2.68e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 858-952
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000243
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1037-1141
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000157
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1138-1227
Classification Level Classification E-value
Superfamily E set domains 0.00000134
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006992
Domain Number - Region: 809-841
Classification Level Classification E-value
Superfamily Plexin repeat 0.000115
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number - Region: 654-686
Classification Level Classification E-value
Superfamily Plexin repeat 0.0379
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006992   Gene: ENSGGOG00000007146   Transcript: ENSGGOT00000007178
Sequence length 1894
Comment pep:novel chromosome:gorGor3.1:7:130292335:130677103:-1 gene:ENSGGOG00000007146 transcript:ENSGGOT00000007178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESRWLELSGANSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIYFRGELCCA
RRKKRSYSKGLVRLATKLIDIHSFTSMHSLPAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences ENSGGOP00000006992 ENSGGOP00000006992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]