SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007033 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007033
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 53-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-18
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007033   Gene: ENSGGOG00000007184   Transcript: ENSGGOT00000007219
Sequence length 607
Comment pep:novel chromosome:gorGor3.1:10:136892232:136907957:-1 gene:ENSGGOG00000007184 transcript:ENSGGOT00000007219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVRRLMPLTLLILSCLAELTMAEAEGNASCTVSLGGANMAETHKAMILQLNPSENCTW
TIERPENKSIRIIFSYVQLDPDGSCESENIKVFDGTSSNGPLLGQVCSKNDYVPVFESSS
STLTFQIVTDSARIQRTVFVFYYFFSPNISIPNCGGYLDTLEGSFTSPNYPKPHPELAYC
VWHIQVEKDYKIKLNFKEIFLEIDKQCKFDFLAIYDGPSTNSGLIGQVCGRVTPTFESSS
NSLTVVLSTDYANSYRGFSASYTSIYAENINTTSLTCSSDRMRVIISKSYLEAFNSNGNN
LQLKDPTCRPKLSNVVEFSIPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQ
IIVKCEMGHNSTVEIIYITEDDVIQSQNALGKYNTSMALFESNSFEKTILESPYYVDLNQ
TLFVQVSLHTSDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRF
QFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRL
KRDRSASGNSGFQHETHAEETPNQPFNSLHLFSFMVLALNVVIVATITVRHFVNQQADYK
YQKLQNY
Download sequence
Identical sequences G3QW82
XP_018891202.1.27298 ENSGGOP00000007033 ENSGGOP00000007033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]