SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007146 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007146
Domain Number 1 Region: 363-440
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.03e-23
Family Intermediate filament protein, coiled coil region 0.00041
Further Details:      
 
Domain Number 2 Region: 131-165
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000575
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 172-241
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000471
Family Intermediate filament protein, coiled coil region 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007146
Domain Number - Region: 264-360
Classification Level Classification E-value
Superfamily Prefoldin 0.034
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007146   Gene: ENSGGOG00000007298   Transcript: ENSGGOT00000007334
Sequence length 540
Comment pep:novel chromosome:gorGor3.1:12:50628430:50639565:-1 gene:ENSGGOG00000007298 transcript:ENSGGOT00000007334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAAGKGLSGGFSSRSLYSLGGARSISFN
VASGSGWAGGYGFGRGRASGFAGSMFGSVALGSVCPSLCPPGGIHQVTINKSLLAPLNVE
LDPEIQKVRAQEREQIKVLNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLE
PILEGYISNLRKQLETLSGDRVRLHSELRSVREVVEDYKKRYEEEINKRTTAENEFVVLK
KDVDAAYMSKVELQAKVDALDGEIKFFKCLYEGEIAQIQSHISDTSIILSMDNNRNLDLD
SIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLKHTKNEISELTRLIQRL
RSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEELARMLREYQEL
LSVKLSLDIEIATYRKLLEGEECRMSGEYTNSVSISVINSSMAGMAGTGAGFGFSNAGTY
GYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR
Download sequence
Identical sequences G3QWI7
ENSGGOP00000007146 XP_004053224.1.27298 ENSGGOP00000007146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]