SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007172 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007172
Domain Number 1 Region: 149-470
Classification Level Classification E-value
Superfamily L domain-like 5.78e-64
Family Internalin LRR domain 0.077
Further Details:      
 
Domain Number 2 Region: 32-195
Classification Level Classification E-value
Superfamily L domain-like 4.08e-30
Family Ngr ectodomain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007172   Gene: ENSGGOG00000007329   Transcript: ENSGGOT00000007362
Sequence length 587
Comment pep:novel chromosome:gorGor3.1:3:196035926:196039998:-1 gene:ENSGGOG00000007329 transcript:ENSGGOT00000007362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLDKAMPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWN
AMSLQILNTHITELNESPFLNISALIALRIEKNELSRIMPGAFRNLGSLRYLSLANNKLQ
VLPIGLFQGLDSLESLLLSSNQLVQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLAG
LTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLADIPMGTFDGLVNLQELALQQNQIG
LLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGNSLKELSPGIFGPMPN
LRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQ
DLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMTIQLQNNQLENLPLGIFDHLGK
LCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPASVRGQSLIIINVNVAVP
SVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQ
AQSGLAIAAIVIGIVALACSLAACIGCCCCKKRSQAVLMQMKAPNEC
Download sequence
Identical sequences G3QWL2
ENSGGOP00000007172 ENSGGOP00000007172 XP_004038283.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]