SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007324 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007324
Domain Number 1 Region: 366-678
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.1e-54
Family Integrin alpha N-terminal domain 0.0000521
Further Details:      
 
Domain Number 2 Region: 195-388
Classification Level Classification E-value
Superfamily vWA-like 1.04e-42
Family Integrin A (or I) domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 828-960
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-28
Family Integrin domains 0.0053
Further Details:      
 
Domain Number 4 Region: 678-824
Classification Level Classification E-value
Superfamily Integrin domains 0.00000183
Family Integrin domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007324   Gene: ENSGGOG00000007471   Transcript: ENSGGOT00000007517
Sequence length 1179
Comment pep:novel chromosome:gorGor3.1:17:3738922:3826714:-1 gene:ENSGGOG00000007471 transcript:ENSGGOT00000007517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFHTLLCIASLASLSAFNVDVARPWLTPRGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLNS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARWRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTERELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYVAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLVRILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
RGALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEAELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVIWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHIHGENLFGVEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQQRACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISLDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
Download sequence
Identical sequences ENSGGOP00000007324 ENSGGOP00000007324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]