SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007329 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007329
Domain Number 1 Region: 470-660
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-65
Family Sec7 domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 668-800
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000102
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007329   Gene: ENSGGOG00000007487   Transcript: ENSGGOT00000007523
Sequence length 1003
Comment pep:novel chromosome:gorGor3.1:12:62597:139831:1 gene:ENSGGOG00000007487 transcript:ENSGGOT00000007523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NETVLHQFCCPAADAEQKPACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAPK
AQPQELQEEEERPGAGAASPRAGPQHKASPGRQQPALATALCSHAPAASDYELSLDLKNK
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPT
AESLAAEKALMEGYGLLGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTW
SLKTMCSLQESGAYQLHQALQAAAGPPGLEAEGREPESAGPGPGDDAAETPGLPPAHSGT
LMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEA
PAVGREDASAGDSCAEAGASGAVDEATAPKTEEEEEEEETAEVGRGAEAEAGDVEQLSSS
STSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLN
LFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCV
VDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIF
ILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELK
SNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFND
LLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFC
ALGSDEMQKFVEDLKESIAEVAELEQIRIEWELEKQQGTKTLSFKPSGAQGDPQSKQGSP
TAKREAALRERPAESTVEVSIHNRLQTSQHNSGLGAERGVPVPPPDLQPSPPRQQTPPLP
PPPPPTHPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYTSSSPDSCGSTPLGGPGS
PVKATHQPPLPPPPPPYNHPHQFCPPGSLLHGRRYSSGSRSLV
Download sequence
Identical sequences ENSGGOP00000007329 ENSGGOP00000007329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]