SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007396 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007396
Domain Number 1 Region: 327-481
Classification Level Classification E-value
Superfamily vWA-like 0.00000000161
Family Trunk domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007396   Gene: ENSGGOG00000007552   Transcript: ENSGGOT00000007592
Sequence length 1220
Comment pep:novel chromosome:gorGor3.1:3:185597990:185609618:1 gene:ENSGGOG00000007552 transcript:ENSGGOT00000007592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLYCPSSWTPLPLTDSWVRACANGPCLSVRAAAGGRGPGGAXAACCRALGPGLGTPTP
RRCAQGHLVLDLAQARSTLVLPTGIIAAAGTMTVTLHSSRELPSRPDGVLHVALPTVLTP
LAPPGPSGPPRPPGLCDDSGPVTLLMLPSSPTSCFGVGSPQEEGLAWEEPAAPRDVFSGP
ARCPAPYTFSFEMLVTGPCLLAGLESPSHALRADAPPHASSAATICVTLAEDHHCDRALE
ILLHPSEPHQPHLMLEGGSLSSAEYEARVRARRDFQRLQRRDSDGDRQVWFLQRRFHKDI
LLNPVLALSFCPDLSSKPGHLGTATRELLFLLDSSSAAHKDAIVLAVKSLPPQTLINLAV
FGMLVQPLFPESRPCSDDAVQLICESIETLQVPSGPPDVLAALDWAVGQPQHRAYPRQLF
LLTAASPMAATTHRTLELMRWHRGTASRCFSFGLGPTCHQLLQGLSALSRGQAYFLRPGQ
RLQPMLVQALRKALEPALSDISVDWFVPDTVEALLTPREIPALYPGDQLLGYCSLFRVDG
FRSRPPGGQEPGWQSSGGSVFPSPEEAPSAASPGTEPTGTSEPLGTGTVSAELSSPWAAR
DSEQSTDALTDPVTDPGPNPSDTAIWRRIFQSSYIREQYVLTHCSASPEPGPGSTGSSES
PGSQGPGSPEGSAPLEPPSQQGCRSLAWGEPAGSRSCPLPAPTPAPFKVGALSTEVLGRQ
HRAALAGRSLSSPPGRANQVPGRPRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPM
DWDMLMEPPFLFTAVPPSGESAPPAVPPQAPRCHVVIRGLCGEQPMCWEVGVGLETLWGP
GDGSQPPSPPVREAAWDQALHRLTAASVVRDNEQLALRGGAETTADRGHARRCWLRALQT
SKVSSAPSCFTCPVAVDATTREVLPGALQVCSSEPAEPPGTPPASHSHLDAAPLPAVVYS
KGLQRGSPAGAWDSYQNGNSKRALGDPATPTEGPRRPPPRPPPRPPCRLSMGRRHKLCSP
DPGQANNSEGSDHDYLPLVRLQEAPGSFRLDAPFCAAVRISQERLCRASPFAVHRASLSP
TSASLPWALLGPGVGQGDSATASCSPSLSSGSEGPGQVDSGRGSDTEASEGAEGLGGTDL
RGRTWATAVALAWLEHRCAAAFGEWELTAAKADCWLRAQHLPDGLDLAALKAAARGLFLL
LRHWDQNLQLHLLCYSPANV
Download sequence
Identical sequences ENSGGOP00000007396 ENSGGOP00000007396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]