SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007441 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007441
Domain Number 1 Region: 430-559
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 2 Region: 366-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000227
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 604-729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 4 Region: 805-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000002
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 5 Region: 330-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000317
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 288-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 780-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000382
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007441
Domain Number - Region: 406-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0597
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007441   Gene: ENSGGOG00000007597   Transcript: ENSGGOT00000007639
Sequence length 1219
Comment pep:novel chromosome:gorGor3.1:14:87205527:87232519:-1 gene:ENSGGOG00000007597 transcript:ENSGGOT00000007639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRRCARPRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYHQDPGLVVIPFQFAWP
RSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCD
ENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVP
GECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLNYCGSHHPCTN
GGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSG
PTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCK
NLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELER
DECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYY
CSCPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGN
FSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCL
PDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACP
PGWKGSTCAVDPLPSLLPNQIPTTATLCLGEWHPGGHSRGGWDLAYHGGPPDAHPLLCSY
NGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAG
PRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEA
LSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLRFNR
DHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDS
SLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACV
VLCVWWTRKRRKERERSRLPREESTNNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPR
RADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHKFTKDPGRSPGRPGHWASGP
KVDNRAVRSINEARYAGKE
Download sequence
Identical sequences ENSGGOP00000022478 ENSGGOP00000007441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]