SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007520 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007520
Domain Number 1 Region: 179-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.27e-49
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 499-624
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 2.88e-29
Family Initiation factor IF2/eIF5b, domain 3 0.0016
Further Details:      
 
Domain Number 3 Region: 351-434
Classification Level Classification E-value
Superfamily Translation proteins 1.79e-22
Family Elongation factors 0.013
Further Details:      
 
Domain Number 4 Region: 619-718
Classification Level Classification E-value
Superfamily Translation proteins 2.87e-22
Family Elongation factors 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007520   Gene: ENSGGOG00000007681   Transcript: ENSGGOT00000007722
Sequence length 727
Comment pep:novel chromosome:gorGor3.1:2a:56235223:56262283:-1 gene:ENSGGOG00000007681 transcript:ENSGGOT00000007722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVWTAQLYAWSWPTDVLTG
AALSQYRLLVTKKEEGPWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNT
DIDIDSLDADSHLDEVWIKEVITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRS
PVVTIMGHVDHGKTTLLDKFRKTQVAAMETGGITQHIGAFLVSLPSGEKITFLDTPGHAA
FSAMRARGAQVTDIVILVVAADDGVMKQTVESIQHAKDAQVPIILAINKCDKAEADPEKV
KKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVI
ESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITG
WRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHQEAHQKAREK
YGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDA
SHECELELVHFGVGDISANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIY
RLVEDLQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFK
LTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDNMEFQVGDRIVCYEEKQIQAK
TSWDPGF
Download sequence
Identical sequences G3QXH7
ENSGGOP00000007520 ENSGGOP00000007520 XP_004029303.1.27298 XP_018876596.1.27298 XP_018876597.1.27298 XP_018876598.1.27298 XP_018876599.1.27298 XP_018876600.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]