SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007543 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007543
Domain Number 1 Region: 37-144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.11e-16
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007543   Gene: ENSGGOG00000007712   Transcript: ENSGGOT00000007745
Sequence length 263
Comment pep:novel chromosome:gorGor3.1:1:38874979:38897377:-1 gene:ENSGGOG00000007712 transcript:ENSGGOT00000007745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKKKLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences G3QXJ8
ENSGGOP00000007543 XP_004025532.1.27298 XP_004025533.1.27298 ENSGGOP00000007543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]