SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007655 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007655
Domain Number 1 Region: 227-452
Classification Level Classification E-value
Superfamily vWA-like 8.26e-61
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 30-221
Classification Level Classification E-value
Superfamily vWA-like 1.7e-53
Family Integrin A (or I) domain 0.00026
Further Details:      
 
Domain Number 3 Region: 453-495
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000000000183
Family Chicken cartilage matrix protein 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007655   Gene: ENSGGOG00000007826   Transcript: ENSGGOT00000007861
Sequence length 496
Comment pep:novel chromosome:gorGor3.1:1:31748216:31760519:-1 gene:ENSGGOG00000007826 transcript:ENSGGOT00000007861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLSGTSLMLCSLLLLLQAPCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKV
KVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMT
GLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGV
GRVDKATLRQIASEPQDEHVDYVESYSIIEKLSRKFQEAFCVVSDLCATGDHDCEQVCIS
SPGSYTCACHEGFTLNSDGKTCSVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFINQ
IVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKY
LIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELR
EIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDLCACESLVKFQAKVEGLLQALTRK
LEAVSKRLAILENTVV
Download sequence
Identical sequences ENSGGOP00000007655 ENSGGOP00000007655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]