SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007691 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007691
Domain Number 1 Region: 183-396
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.03e-41
Family mRNA capping enzyme 0.00027
Further Details:      
 
Domain Number 2 Region: 5-132
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-33
Family Dual specificity phosphatase-like 0.000000528
Further Details:      
 
Domain Number 3 Region: 398-511
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.34e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007691   Gene: ENSGGOG00000007863   Transcript: ENSGGOT00000007898
Sequence length 532
Comment pep:novel chromosome:gorGor3.1:6:88687816:89040424:-1 gene:ENSGGOG00000007863 transcript:ENSGGOT00000007898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVH
CTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDIEEAPP
PPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKGVTQVT
TQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLID
GTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDII
KFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLL
EGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQN
VGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAV
CNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPRPLT
Download sequence
Identical sequences ENSGGOP00000007691 ENSGGOP00000007691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]