SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007724 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007724
Domain Number 1 Region: 272-312,340-450
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000422
Family beta 1,4 galactosyltransferase (b4GalT1) 0.043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007724
Domain Number - Region: 59-100
Classification Level Classification E-value
Superfamily Prefoldin 0.0146
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007724   Gene: ENSGGOG00000007891   Transcript: ENSGGOT00000007931
Sequence length 455
Comment pep:novel chromosome:gorGor3.1:10:54925434:54946310:1 gene:ENSGGOG00000007891 transcript:ENSGGOT00000007931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRMPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQ
ALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPS
DLLEFLHSQIDKAEVNIGAKLPSEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRD
ELVEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFVEGYYRTERDKGTQYELFFK
KADLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIH
QDKKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDK
GEVLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQL
VHKKDSGFWRDFGFGMTCQYRSDFLTIGKYTLHLR
Download sequence
Identical sequences ENSGGOP00000007724 ENSGGOP00000007724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]