SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007795 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007795
Domain Number 1 Region: 601-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-82
Family Protein kinases, catalytic subunit 0.000000000115
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-67
Family Ephrin receptor ligand binding domain 0.00000881
Further Details:      
 
Domain Number 3 Region: 893-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.8e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Domain Number 4 Region: 433-523
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-18
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 5 Region: 253-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000066
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007795   Gene: ENSGGOG00000007964   Transcript: ENSGGOT00000008004
Sequence length 972
Comment pep:novel chromosome:gorGor3.1:1:16594603:16631454:-1 gene:ENSGGOG00000007964 transcript:ENSGGOT00000008004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPVSMPCTRPPSAPHYLTAVSVSLSTKLYFTYPKGGGDLENI
SFNTTQYATTPWSGLLPCPTWVCSVIDPWPPFTLWPCVFVPLGIQYWLSTFHIQIQNSDL
QLLTHFPHCLSCPEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNV
RRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGSVAVG
VVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKF
TTEIHPSCVTRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEA
GIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIA
AGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWT
APEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPS
AIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGV
PFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLG
LKDQVNTVGIPI
Download sequence
Identical sequences ENSGGOP00000008209 ENSGGOP00000007795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]