SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007876 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007876
Domain Number 1 Region: 312-608
Classification Level Classification E-value
Superfamily L domain-like 1.36e-41
Family Leucine rich effector protein YopM 0.058
Further Details:      
 
Domain Number 2 Region: 34-284
Classification Level Classification E-value
Superfamily L domain-like 4.03e-36
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007876   Gene: ENSGGOG00000008057   Transcript: ENSGGOT00000008091
Sequence length 692
Comment pep:novel chromosome:gorGor3.1:3:198303318:198324658:1 gene:ENSGGOG00000008057 transcript:ENSGGOT00000008091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLPLWLCLGFHFLTVDWRNRSGTATAASQGGCKLVGGAADCRGQSLASVPSSLPPHAR
MLILDANPLRTLWNHSLQPYPLLESLSLHSCHLERISRGAFQEQGHLRSLVLGDNCLSEN
YKETAAALHALPGLRRLDLSGNSLTEDMAALMLRNLSSLRSVSLAGNTIMRLDDSVFEGL
ERLRELDLQRNYIFEIEGGAFDGLTELRHLSLAFNNLPCIVDFGLTQLRVLNVSYNVLEW
FLAAGGEAAFELETLDLSHNQLLFFPLLPQRSKLRTLLLRDNNMGFYRDLYNTSSPREMV
AQFLLVDGNVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGFLRKMPSLSHLNLN
RNCLMTLHIREHEPPGALTELDLSHNQLSELHLAPGLASCLGSLRSFNLSSNQLLGVPPG
LFANARNITALDMSHNQISLCPLPAASDRVGPPSCVDFRNMASLRSLSLEGCGLGALPDC
PFRGTSLTYLDLSSNWGVLNGSLAPLQDVAPTLQVLSLRNMGLHSSFMALDFSGFGNLRD
LDLSGNCLTTFPRFGGSLALETLDLRRNSLTALPQKAVSQQLSRGLRTIYLSQNPYDCCG
VDGWEALRHGQTVADWAMVTCNLSSKIIRVTELPGGVPRDCKWERLDLGLLYLVLILPSC
LTLLVACTVIVLTFKKPLLQVIKSRCHWSSVY
Download sequence
Identical sequences G3QYE3
ENSGGOP00000007876 XP_004038304.1.27298 ENSGGOP00000007876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]