SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007909 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007909
Domain Number 1 Region: 275-620
Classification Level Classification E-value
Superfamily L domain-like 6.12e-45
Family Ngr ectodomain-like 0.058
Further Details:      
 
Domain Number 2 Region: 30-215,268-382
Classification Level Classification E-value
Superfamily L domain-like 1.97e-38
Family Ngr ectodomain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007909   Gene: ENSGGOG00000008093   Transcript: ENSGGOT00000008125
Sequence length 661
Comment pep:novel chromosome:gorGor3.1:17:29645807:29660265:1 gene:ENSGGOG00000008093 transcript:ENSGGOT00000008125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFDVSCFFWVVLFSAGCKVITSWDQMCTEKEANKTYNCENLGLSEIPDTLPNTTEFLEF
SFNFLPTIHNRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETS
LNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDF
QNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFN
GLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQKHHFSDISSTTFQCFTQL
QELDLTATHLKGLPSGIKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLH
LGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNH
FQDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSL
SHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFVTWYKENLHKLE
GSEETTCANPPSLRGVKLSDVKLSCGITAIGIFFLIVFLLLLAILLFFAVKYFLRWKYQH
I
Download sequence
Identical sequences G3QYH4
ENSGGOP00000007909 XP_004058808.1.27298 ENSGGOP00000007909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]