SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007930 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007930
Domain Number 1 Region: 205-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000837
Family Growth factor receptor domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007930
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007930   Gene: ENSGGOG00000008109   Transcript: ENSGGOT00000008147
Sequence length 361
Comment pep:novel chromosome:gorGor3.1:22:34780090:34789514:1 gene:ENSGGOG00000008109 transcript:ENSGGOT00000008147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHL
EAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQ
GDGSCRCHRGYQGPLCTDCMDGYFSSLRNETHSICTVRTGLSDSYPPCCLSLGCWRGVGH
AWIRGRNTHTQPGYSSRVWIAAFSPACDESCKTCSGLTNRDCGECEVGWVLDEGACXXVD
ECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECIPGYARERGQCADVD
ECSLAEKACAKKDENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGENPTQLPSRED
L
Download sequence
Identical sequences ENSGGOP00000007930 ENSGGOP00000007930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]