SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008240 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008240
Domain Number 1 Region: 48-176
Classification Level Classification E-value
Superfamily L domain-like 4.16e-25
Family Ngr ectodomain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008240   Gene: ENSGGOG00000008435   Transcript: ENSGGOT00000008468
Sequence length 257
Comment pep:novel chromosome:gorGor3.1:21:33116125:33116918:1 gene:ENSGGOG00000008435 transcript:ENSGGOT00000008468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVRPPRPLLLLVSTRESCLFLLFCLHLGAACPQPCRCPDHAGAVAVFCSLRGLQEVPE
DIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGPATFAGLAGGLRLLDL
SYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEF
VGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYVVYYVRHNQEDARRHLEYL
KSLPSAPASKDPIGPGP
Download sequence
Identical sequences G3QZD3
ENSGGOP00000008240 XP_004062945.1.27298 ENSGGOP00000008240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]