SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008309 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008309
Domain Number 1 Region: 932-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-37
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1390-1506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-36
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 3156-3281
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-35
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 4 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-34
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 5 Region: 1169-1277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 6 Region: 2227-2333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 1738-1848
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-33
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 8 Region: 1620-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-33
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 9 Region: 3404-3509
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 10 Region: 1053-1158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-31
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 11 Region: 1509-1617
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 12 Region: 3513-3624
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 13 Region: 1857-1964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-29
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 14 Region: 1990-2089
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-29
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 15 Region: 1278-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 16 Region: 824-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 17 Region: 2091-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 18 Region: 2568-2684
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-26
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 19 Region: 469-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-25
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 20 Region: 708-814
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 21 Region: 2795-2908
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 22 Region: 2703-2791
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-19
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 23 Region: 3288-3398
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-18
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 24 Region: 2336-2446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-16
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 25 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000457
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 26 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 27 Region: 2911-2956
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000602
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 28 Region: 2492-2569
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000824
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 29 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family EGF-type module 0.023
Further Details:      
 
Domain Number 30 Region: 264-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 31 Region: 183-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008309
Domain Number - Region: 214-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0097
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008309   Gene: ENSGGOG00000008467   Transcript: ENSGGOT00000008538
Sequence length 3626
Comment pep:novel chromosome:gorGor3.1:10:17310927:17620607:-1 gene:ENSGGOG00000008467 transcript:ENSGGOT00000008538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMNMSLPFLWSLLTLLTFAEVNGEAGELELQRQKRSIHLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKDDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLIREQAGE
PKYSCICDAGWMSSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YVCEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLIDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDAVSGYFCKC
DSGWTGVNCTENINECLSSPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPDCGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPLLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGGELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFSINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRRMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGYPNRYPPNKECIWYIRTAPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPDNYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPVRGRYCGTDMPHPITSFSSALTLRFVSDSSMSAGGFHTTVTASVSTCGG
TFYMAEGIFNSPGYPDVYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
IYSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDQFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAAQCGGR
VTGQSGVVESIGHPTLPYRDNLFCEWHLHGLSGHYLTISFEDFNLQNSSGCEKDFVEIWD
NHTSGYTGGWSCISAALSRGTEGLLVGEHCYVTSMSPTSSGFRCAFSTLSFLQGTIIIPF
IILFPSSNNYINKEEVEKILTTPTIPHFDSFSHLFLAKHTLCTCNHHYLVFNGIRSNSPQ
LEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNIPEGNF
TSPGYDGVRNYSRNLNCEWTLSNPNQENSSISIHFEDFYLESHQDCQFDVLEFRVGDADG
PLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTVCKCVAIPNQGNVFS
QNFQENLHQLTTHFFFLLKLTFSDFDIEHHTTCAWDSITVKNGGSPESPIIGQYCGNSNL
RTIESGSNELFLTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPHWPQNFPENS
RCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAPG
PVITPSNTFTAVFQSQEAPAQGFSASFVSRCGRNFTGPSGYIVSPNYPKQYDNNMNYTYV
IEANPLFLSLTISMLTFIEYHHRARDSLATVKCSDGIYRTLEYDILSAIFSYICQDSLNG
KLSSKWQIVFNLYSNFQMSNKGVEIIGKNVKCLKGSGGELVGNTDRGIIQQPEKKSYLSV
DNDINCMQMALEAQKKGSRKKTKQFHLKPSRMFLHEYTALVMGPQTSLPASVPGCRKKAP
PNVESSLFTYLILYKTGFFKARKIFNKSHEQSQKRPQQGCGGYLTGSNNTFASPDSDSNG
MYDKNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFC
GSTVPAPFMSSGNFLTVQFISDLTLEREGFNATYTIMDMPCSGTYNATWTPQNISSPNSS
DPDVPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRIQFCGRN
ASAVPVFYSSMSTAIVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPRNYDN
DKDCTVTLTAPQNHTISLFFHSFGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNP
VFSQNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTHC
EWVLVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVA
SSNQVFIKFHADYARRPSAFRLTWDS
Download sequence
Identical sequences ENSGGOP00000022747 ENSGGOP00000008309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]