SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008446 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008446
Domain Number 1 Region: 956-1112
Classification Level Classification E-value
Superfamily vWA-like 1.91e-19
Family Integrin A (or I) domain 0.017
Further Details:      
 
Domain Number 2 Region: 507-624
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000475
Family Ku80 subunit N-terminal domain 0.081
Further Details:      
 
Domain Number 3 Region: 167-328
Classification Level Classification E-value
Superfamily vWA-like 0.0000000544
Family Integrin A (or I) domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008446   Gene: ENSGGOG00000008631   Transcript: ENSGGOT00000008678
Sequence length 1180
Comment pep:novel chromosome:gorGor3.1:16:22681749:22746018:1 gene:ENSGGOG00000008631 transcript:ENSGGOT00000008678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQYRKISIGCFAMATQTSHVFHGQENMFLENYCIRRNTGRGSKKPLKQKNMNGLGQNSD
NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEG
TNVVQKICFSTEIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAI
SSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNARSLWPDPMEVSASTLQELKLWVKT
LQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITY
RCDDQMPPAVLKNLAEAVRGYYHCYSPKMEHYTSRDMDELLAEIQKAQSLLSHVQALQHS
SPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLDKTSAEWLKVNGLKAKK
LSLYQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQK
QLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQ
LSNKDYFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVD
FKDKDKHQSQGIYLFTGGIPDQDMVGRPRPGCPLSFATSSVFPQVDTLPRFLQHDFLASG
YNEICLWRAYRERTDLGSRGLEDYCIYESDDINSIMSEMEKALNYSQKCAFLMASLKNHS
GKVLGSSALPKEKPKTLQLRSQPKKLCPPRPTVPLGARMSIKDDPDREKSPPLKSLKWRP
LSSRVGISPAVAQPMKEGMMELRRKTKSREAETSLLLFYTEKGNNVGSVYKKYPQGRGLR
RTSSSIDLPRKDTVCSSQEWVAKYGLKKLKLEISRCMGPNCTHQKSGQRSASAKHCSIFP
SVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSAGSRRLFGTVLESKVCILL
DTSGSMGPYLQQVKTELVLLIWEQLWKCCDSFNLLSFAESLQSWQDTLVETTDAACHEAM
QWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKV
HTISLNCSDRAAVEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLPPFEG
DDLRILAQEITKARSFLWQAQSFRSQLQKKNDAEPKVSLS
Download sequence
Identical sequences ENSGGOP00000019071 ENSGGOP00000008446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]