SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008486 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008486
Domain Number 1 Region: 71-147
Classification Level Classification E-value
Superfamily Translation proteins 3.88e-18
Family Gar1-like SnoRNP 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008486   Gene: ENSGGOG00000008681   Transcript: ENSGGOT00000008719
Sequence length 217
Comment pep:novel chromosome:gorGor3.1:4:119206321:119215541:1 gene:ENSGGOG00000008681 transcript:ENSGGOT00000008719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNK
GQDQGPPERVVLLGEFMHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQL
RDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGR
GGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH
Download sequence
Identical sequences G3R011
ENSGGOP00000008486 ENSGGOP00000008486 XP_004040323.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]