SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008508 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008508
Domain Number 1 Region: 329-522
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 53-155
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000269
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 167-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000114
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008508   Gene: ENSGGOG00000008698   Transcript: ENSGGOT00000008741
Sequence length 1162
Comment pep:novel chromosome:gorGor3.1:11:108331152:108452061:-1 gene:ENSGGOG00000008698 transcript:ENSGGOT00000008741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFHQQKMKTLAERRRSAPSLILDKALQKRPTTRDSPSASVDTCTFLSSFVCSNRTLLID
GRAELKRGLQRQERHLFLFNDLFVVAKIKYNNNFKIKNKIKLTDMWTASCVDEVGEGNTN
AMKSFVLGWPTVNFVATFSSPEQKDKWLSLLQRYINLEKEKDYPKSIPLKIFAKDIGNCA
YSKTITVMNSDTANEVINMSLPMLGITGSERDYQLWVNSGKEEAPYPLIGHEYPYGIKMS
HLRDSALLTPGSKDSTTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFK
RRRSIINWAFWRGSSTHLDNLPTSPTSPMPGQLFGISLPNICENDNLPKPVLDMLFFLNQ
KGPLTKGIFRQSANVKSCRELKEKLNSGVEVHLDCESIFVIASVLKDFLRNIPGSIFSSD
LYDHWVSVMDQGNDEEKINTVQRLLDQLPRANVVLLRYLFGVLHNIEQHSSSNQMTAFNL
AVCVAPSILWPPTSSSPELENEFTKKVSLLIQFLIENCLRIFGEEITSLFREVSVRCDTR
ENASDISCFQLNDSSYDSLENELNEDVDAPCSDLVKKLGQGSRSMDSVLTLSDYDLDQPE
VEGLLTLSDFDLAHSKDEDVQMKRPLASKPVNILVYTKIPLRDHARAPSAMCTPSYLSTA
AANAAKSLRRHRRSSEPSIDYLDSKLSYLREFYQKKLRKSSCDAILSQKDEDYLKQNQPL
QEEGKTCFKQSLVTGTDVSKKNATTQNTKKKSLSGSEGNHVKLLPKSKPVAISVASYSPM
SSQDHSKNQPFDVNISGYSPPHTADALKGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQH
KTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTEKVLPPRLNL
CPRTSYSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRKQEELS
PDFSNASHVSGMPGPSSGQACSRPAYTKKDTMEWHSQMHSVTLHPSTWLRNGVASLKNWS
LKKKAKAARPEEEKIASPKGPLEPPPHASGVPEANSLQEEQKDLPLRAAEGLSPVQSAQR
CSSSPFQDSERHCSSPFSLVESRLKLCMKSHEEIEPGSQSSSGSLPWERASASSWTLEDA
TSPDSGPTVVCDIEDRYLTKDI
Download sequence
Identical sequences ENSGGOP00000008508 ENSGGOP00000008508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]