SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008548 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008548
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000044
Further Details:      
 
Domain Number 2 Region: 259-417
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 7.32e-47
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000763
Further Details:      
 
Domain Number 3 Region: 596-759
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.49e-39
Family AlaX-like 0.034
Further Details:      
 
Domain Number 4 Region: 514-592
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000207
Family AlaX-M N-terminal domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008548   Gene: ENSGGOG00000008737   Transcript: ENSGGOT00000008782
Sequence length 967
Comment pep:novel chromosome:gorGor3.1:16:60442112:60473541:-1 gene:ENSGGOG00000008737 transcript:ENSGGOT00000008782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGRERQALSDTLTV
GSHVSEAEHSSIELLLVQTGIYTENNLTPKSIQASLQNEYILYRVLHSLMESQHAKSLMS
LLPKYNWTIRRESSKTVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGGQ
IYDEGYLVKVDDSSEDKTEFTVKNAQVRAGYVLHIGTIYGDLKVGDQVWLFIDEPRRRPI
MSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIE
AAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSVE
FCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAKV
KAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRV
LEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITC
LCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQL
RLGDVKN
Download sequence
Identical sequences ENSGGOP00000024184 ENSGGOP00000008548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]