SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008716 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008716
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008716
Domain Number - Region: 87-146
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0229
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008716   Gene: ENSGGOG00000008917   Transcript: ENSGGOT00000008953
Sequence length 255
Comment pep:novel chromosome:gorGor3.1:9:75017127:75043469:1 gene:ENSGGOG00000008917 transcript:ENSGGOT00000008953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPPQATFQVLRGNGASVGTVLMFR
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMS
MAFLTCCLLKCVKKSERRRSNRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHD
NHSFTTDHGESTSKLASVTCSVDKDPGIPRALSLSGSSSSPQAQVMVHMANPRQPLPACG
LATGMPQQPTAYALG
Download sequence
Identical sequences ENSGGOP00000008716 ENSGGOP00000008716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]