SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008774 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008774
Domain Number 1 Region: 297-621
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-89
Family p120GAP domain-like 0.0000706
Further Details:      
 
Domain Number 2 Region: 582-715
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-46
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-26
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 4 Region: 20-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.83e-23
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008774   Gene: ENSGGOG00000008967   Transcript: ENSGGOT00000009013
Sequence length 836
Comment pep:novel chromosome:gorGor3.1:13:97121916:97229392:-1 gene:ENSGGOG00000008967 transcript:ENSGGOT00000009013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVCDVAGNKHFYAADDFLGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEA
KKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEEDVDKLEIRVDLWNASNLKFGD
EFLGELRIPLKVLRQSSSYEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYY
SPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAVPLVRLFLHYGRVVPFISAIASAEV
KRTQDPNTIFRGNSLASKCIDETMKLAGMHYLHVTLKPAIEEICQSHKPCEIDPVKLKDG
ENLENNMENLRQYVDRVFHAITESGVSCPTVMCDIFFSLREAAAKRFQDDPDVRYTAVSS
FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTVQTLGSLSKSKSASFKESYMAT
FYEFFNEQKYADAVKNFLDLISSSGRRDPKSVEQPIMLKRGEGFMIKRAQGRKRFGMKNF
KKRWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQ
ANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPA
NIQSDVHGPKGKGRVMSIFQLLLRWLVKSKEACGSKSVYDGPEQEEYSTFVIDDPQETYK
TLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
Download sequence
Identical sequences ENSGGOP00000008774 ENSGGOP00000027732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]