SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008806 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008806
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.52e-52
Family Cofilin-like 0.0000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008806   Gene: ENSGGOG00000009007   Transcript: ENSGGOT00000009046
Sequence length 165
Comment pep:novel chromosome:gorGor3.1:20:17987344:18025533:1 gene:ENSGGOG00000009007 transcript:ENSGGOT00000009046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDV
GVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASS
KDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Download sequence
Identical sequences A0A096NVM2 A0A0D9RGV9 A0A0P6IWC8 A0A1S2ZWQ8 A0A1S3G179 A0A250YAX0 A0A2I3FXN4 A0A2K5DT68 A0A2K5NRC1 A0A2K5R502 A0A2K5U939 A0A2K6BB65 A0A2K6NR24 A0A2K6UT67 F7I5M6 G1TMV1 G3R0W0 H2P133 H2QK00 H9EM17 P60981 P60982 Q5E9D5 V9HWA6
ENSOCUP00000018315 ENSNLEP00000011787 gi|5802966|ref|NP_006861.1| ENSBTAP00000020512 ENSCJAP00000008960 ENSNLEP00000011787 ENSOPRP00000000889 400392 ENSOCUP00000018315 ENSDNOP00000004679 HGL_H00000246069 ENSPPYP00000011991 ENSOPRP00000000889 ENSP00000246069 ENSFCAP00000019429 ENSPPYP00000011991 ENSBTAP00000020512 ENSGGOP00000008806 ENSFCAP00000012140 ENSP00000246069 ENSPTRP00000022766 ENSCJAP00000008960 ENSPVAP00000000390 ENSPTRP00000022766 ENSP00000246069 9598.ENSPTRP00000022766 9600.ENSPPYP00000011991 9606.ENSP00000246069 9685.ENSFCAP00000012140 9913.ENSBTAP00000020512 9986.ENSOCUP00000018315 ENSPVAP00000000390 ENSGGOP00000008806 NP_001004031.1.46622 NP_001015586.1.59421 NP_001015586.1.76553 NP_001182421.1.72884 NP_006861.1.87134 NP_006861.1.92137 XP_002711006.1.1745 XP_002747513.1.60252 XP_003983850.1.62641 XP_004412351.1.74151 XP_004472450.1.11602 XP_004687210.1.23501 XP_004754249.1.14098 XP_004840912.1.39548 XP_005380964.1.28644 XP_005568355.1.63531 XP_006077288.1.26621 XP_006088037.1.53796 XP_006749365.1.47382 XP_006921633.1.64745 XP_007525775.2.11023 XP_007958946.1.81039 XP_008139334.1.99482 XP_008708238.1.72690 XP_008961171.1.60992 XP_008994040.1.60252 XP_009231596.1.23681 XP_009435111.1.37143 XP_009435112.1.37143 XP_010342042.1.74449 XP_010379777.1.97406 XP_010589823.1.64505 XP_010632438.1.5607 XP_011368749.1.92234 XP_011527444.1.92137 XP_011527445.1.92137 XP_011748244.1.29376 XP_011907404.1.92194 XP_012023386.1.54773 XP_012330221.1.9421 XP_012375529.1.11602 XP_012614988.1.48125 XP_012882563.1.60039 XP_014955131.1.66739 XP_015333118.1.40921 XP_015338632.1.40921 XP_016020379.1.101085 XP_017368194.1.71028 XP_017368195.1.71028 XP_017510323.1.32401 XP_017912713.1.57651 XP_018872544.1.27298 XP_019318039.1.44245 XP_019481753.1.44202 XP_019612201.1.88060 XP_020734710.1.74333 XP_021556420.1.83697 XP_514526.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]