SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008911 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008911
Domain Number 1 Region: 372-805
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-47
Family Integrin alpha N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008911   Gene: ENSGGOG00000009108   Transcript: ENSGGOT00000009157
Sequence length 840
Comment pep:novel chromosome:gorGor3.1:6:25288551:25350769:-1 gene:ENSGGOG00000009108 transcript:ENSGGOT00000009157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFRLWPGLLIVLGSLCHRGSSCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAY
QAGTVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLF
GITSHMAADVSWHSLGIEQGFLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLAR
RWYVPVKDLLGIYEKLYGRKVITENVIVDCSHIQFLEMYGEMLAVSKLYPTYSTKSPFLV
EQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQ
KNDFHRNLTTSLTESIDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQL
SQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY
SNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLT
YKGAVYVYFGSKQGRMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGG
GKQKGIVAAFYSGPSLSDKEKLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSP
TWKNASRLGHLLHIRDEKKSLGRVYGYFPPNGQSWFTISGDKAMGKLGTSLSSGQILMNG
TLTQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSDVQPLLLSTFSGDRRFSRFGG
VLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGDMTGKCKSWIT
PCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD
Download sequence
Identical sequences A0A2I2YDH8
XP_004043388.1.27298 XP_018884955.1.27298 ENSGGOP00000008911 ENSGGOP00000008911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]