SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008992 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000008992
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily HAD-like 0.0989
Family Phosphoserine phosphatase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008992   Gene: ENSGGOG00000009208   Transcript: ENSGGOT00000009242
Sequence length 36
Comment pep:novel chromosome:gorGor3.1:6:116700512:116700619:1 gene:ENSGGOG00000009208 transcript:ENSGGOT00000009242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKILPRMISHSELRKLFYSADAVCFDVDSTVISEEG
Download sequence
Identical sequences ENSGGOP00000008992 ENSGGOP00000008992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]