SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009150 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009150
Domain Number 1 Region: 4-375
Classification Level Classification E-value
Superfamily Translation proteins 1.59e-103
Family Ribosomal protein L3 0.00000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009150   Gene: ENSGGOG00000009364   Transcript: ENSGGOT00000009404
Sequence length 407
Comment pep:novel chromosome:gorGor3.1:16:2060274:2070423:-1 gene:ENSGGOG00000009364 transcript:ENSGGOT00000009404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHI
MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
Download sequence
Identical sequences G3R1R9 Q92901
ENSP00000268661 ENSP00000268661 ENSP00000268661 9606.ENSP00000268661 ENSGGOP00000009150 NP_005052.1.87134 NP_005052.1.92137 XP_003807730.1.60992 XP_004057025.1.27298 gi|4826988|ref|NP_005052.1| ENSGGOP00000009150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]